Session 32: Efficacy in ART

نویسندگان
چکیده

برای دانلود باید عضویت طلایی داشته باشید

برای دانلود متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

O-32: Status of Human ART in Spain: Resultsfrom the New Registry of Catalonia

Background: FIVCAT.NET is the registry of human assisted reproductive techniques (ART) in Catalunya to which all authorised centres are obliged to declare their activities. The Background of the present study is to describe the data on effectiveness of the ART in Catalunya over the period 2001-2005 and to compare our findings with other similar registries. Materials and Methods: The data were o...

متن کامل

I-32: Prevention Protocols in Order to Prevent OHSS in COS of PCO and Non PCO Patients in ART Cycle

Background: The affordable protocol to prevent the severe OHSS in two groups of patients PCO syndrome and non PCO high responder. Methods and Materials: PubMed and Medline were searched from January 2000 till end of May 2014. This Study investigates whether the mild protocol is associated to prevent severe OHSS in infertile female. Results: According to this survey, 9 studies were included and ...

متن کامل

ISSCC 2006 / SESSION 32 / PLLs , VCOs , AND DIVIDERS / 32 . 2 32 . 2 A 0 . 5 to 2 . 5 GHz PLL with Fully Differential Supply - Regulated Tuning

PLLs are important building blocks that are used to generate and distribute clocks in all high-performance digital systems. Integrating PLLs on large digital chips in deep submicron processes poses three main challenges. First, power supply noise caused by increased digital switching currents degrades the jitter performance of the VCO. Second, the wide loop bandwidth required to suppress ring o...

متن کامل

the efficacy of recombinant versus urinary hcg in art outcome

background: human chorionic gonadotropin (hcg) has been used as a replacement for the mid-cycle luteinizing hormone (lh) surge for several years. the recent arrival of recombinant dna technology has made recombinant hcg (rhcg) accessible. objective: to assess efficacy of rhcg compared to urinary hcg (uhcg) for triggering of ovulation and induction of final oocyte maturation in assisted reproduc...

متن کامل

DARPP - 32 : Regulator of the Efficacy of Dopaminergic Neurotransmission

Immunol. 157, 207 (1996). 10. D. L. DiGiusto and E. Palmer, Mol. Immunol. 31, 693 (1994). 11. The a wild-type, b wild-type, aIII, and bIII constructs have been previously described (8). The a wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS (30), with the a-CPM indicated in bold. The b wild-type amino acid sequence fro...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

ژورنال

عنوان ژورنال: Human Reproduction

سال: 2010

ISSN: 0268-1161,1460-2350

DOI: 10.1093/humrep/de.25.s1.32